Limited-time offer! Save up to 50% Off | Solutions starting at $6 each  

Practical Bioinformatics.

Added on - 20 Sep 2019

Trusted by 2+ million users,
1000+ happy students everyday
Showing pages 1 to 1 of 3 pages
Practical Bioinformatics80%3800 wordsIntroduction:You are required to analyse a protein sequence by bioinformaticsmethods. What is its likely function? If it does not have a structurecan you determine a model for the structure? What does themodel tell you about its function? It might also be a "hypothetical"protein, where the structure has already been determined by astructural genomics consortium. In which case can you usesequence and known structure to determine protein function? Youare not restricted to methods covered in the lectures, but youshould focus on methods with the general aim of prediction ofprotein function and/or structure from sequence.Protein sequence:MSPSVEETTS VTESIMFAIV SFKHMGPFEG YSMSADRAAS DLLIGMFGSV SLVNLLTIIGCLWVLRVTRP PVSVMIFTWN LVLSQFFSIL ATMLSKGIML RGALNLSLCR LVLFVDDVGLYSTALFFLFL ILDRLSAISY GRDLWHHETR ENAGVALYAV AFAWVLSIVA AVPTAATGSLDYRWLGCQIP IQYAAVDLTI KMWFLLGAPM IAVLANVVEL AYSDRRDHVWSYVGRVCTFYVTCLMLFVPY YCFRVLRGVL QPASAAGTGF GIMDYVELAT RTLLTMRLGI LPLFIIAFFSREPTKDLDDS FDYLVERCQQ SCHGHFVRRL VQALKRAMYS VELAVCYFSTSVRDVAEAVKKSSSRCYADA TSAAVVVTTT TSEKATLVEH AEGMASEMCP GTTIDVSAESSSVLCTDGENTVASDATVTA LThere should be an abstract of up to 250 words. An introduction, detailingwhat you have done, and why it is interesting, perhaps with a briefliterature review if relevant.You are not expected to give details forthe methods you have used, but do cite primary references if youuse them. The remainder of the paper should be:Results and Discussion section giving relevant results anddiscussing their significance;Conclusions section where you review the significance of yourresults and comment on the usefulness of the methods used;References.Marks will be awarded as follows:Abstract (5%) - awarded for a clear and concise abstract of thepaper.
You’re reading a preview
Preview Documents

To View Complete Document

Click the button to download
Subscribe to our plans

Download This Document