Limited-time offer! Save up to 50% Off | Solutions starting at $6 each  

Protein Discovery and Analysis PDF

Added on - 27 Jul 2022

pet protein name: BETA GLUCORINIDASE This assignment will require extensive literature searching to locate primary sources in books and journals. We will introduce you to these step in your Week 3 workshop. You will be given the name of a protein of industrial/medical importance. You will need to select a specific species variant that is used in a medical or industrial application. Find out about: 1. The primary structure (amino acid sequence) of your Pet Protein. Prepare your own figure (not a journal extract) of the primary sequence, clearly showing the numbering relevant to the mature sequence. Outline and label any sub-regions or domain units important in this protein. Indicate on this figure the disulfide connections (if any), as well as any amino acids known to be glycosylated. 2. The physico-chemical properties (pI, MW value) of the protein that are important considerations for a purification protocol. Use the tools in ExPASy to analyse your sequence. Check you ha

Trusted by 2+ million users,
1000+ happy students everyday
Showing pages 1 to 4 of 14 pages
Running head: PROTEIN DISCOVERY AND ANALYSIS
BETA GLUCORINIDASE
Name of the Student
Name of the University
Author Note
PROTEIN DISCOVERY AND ANALYSIS1
Table of Contents
Introduction................................................................................................................................2
The primary structure of PET protein........................................................................................2
The physico-chemical properties of PET protein.......................................................................3
Initial purification of the protein................................................................................................8
Present purification of the protein..............................................................................................9
Bibliography.............................................................................................................................11
PROTEIN DISCOVERY AND ANALYSIS2
Introduction
Human beta glucuronidase has been defied as a type of glucuronidase which catalyzes the
hydrolysis of beta D glucuronic acid residue that has been found derived from a non-reducing
mutopolysaccharide in nature. This protein has been found to be located in the lysozyme.
Beta glucuronidase has been found to be secreted fromgusBgene of human (Di et al., 2017).
The protein is synthesised in the form of a monomer of 80 kDa size before proteolysis. After
proteolysis, it has been found to be broken down to 78 kDa monomer, which is the active
protein.
The primary structure of PET protein
1020304050
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRAD
60708090100
FSDNRRRGFEEQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVW
110120130140150
YEREVILPERWTQDLRTRVVLRIGSAHSYAIVWVNGVDTLEHEGGYLPFE
160170180190200
ADISNLVQVGPLPSRLRITIAINNTLTPTTLPPGTIQYLTDTSKYPKGYF
210220230240250
VQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQDSGLVNYQISV
260270280290300
KGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
310320330340350
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNK
360370380390400
HEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYG
410420430440450
IVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVAN
460470480490500
EPASHLESAGYYLKMVIAHTKSLDPSRPVTFVSNSNYAADKGAPYVDVIC
510520530540550
LNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGAETIAGFH
560570580590600
QDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
610620630640650
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLF
T
PROTEIN DISCOVERY AND ANALYSIS3
desklib-logo
You’re reading a preview
Preview Documents

To View Complete Document

Click the button to download
Subscribe to our plans

Download This Document