Strategic Management: External Environment and Market Conditions
Verified
Added on 2023/01/18
|18
|5080
|70
AI Summary
This document discusses the external environment and market conditions faced by Vodafone in strategic management. It includes an analysis of the PESTLE factors and Porter's five forces model. The document also explores the strengths, weaknesses, opportunities, and threats of Vodafone through SWOT analysis and VRIO analysis.
Contribute Materials
Your contribution can guide someone’s learning journey. Share your
documents today.
Strategic Management
Secure Best Marks with AI Grader
Need help grading? Try our AI Grader for instant feedback on your assignments.
Table of Contents INTRODUCTION...........................................................................................................................3 TASK 1............................................................................................................................................3 External environment and market conditions currently faced by the organisation and possible future scenario.......................................................................................................................3 TASK 2............................................................................................................................................6 Use of relevant internal analysis tools to draw appropriate conclusions................................6 TASK 3..........................................................................................................................................10 Discuss the possible strategies that the company could follow to defend its core business10 CONCLUSION..............................................................................................................................13 REFERENCES..............................................................................................................................14
INTRODUCTION Strategic Management is defined as collection of managerial decision and action which determine in achievement of long term performance of business in an effective and efficient manner (Aguinis, Edwards and Bradley, 2017). This includes scanning of environment such as external as well as internal, formulation of strategy, implementation of strategy, evaluation and control. Studying of strategic management focus on evaluating and monitoring of various external market opportunities and threats in order to identify strengths and weaknesses. It provide direction to business and specifying objectives of organisation, developing plans and policies in order to attain those and allocation resources for implementation of set plans. The organisation chosen for given assignment is Vodafone which was established in 1991 by Gerry Whent and Ernest Harrison. It is British multinational telecommunications headquartered in London and Newbury Berkshire. This ranked as 4thin number of mobile consumers in 2018 and serving worldwide. The products of Vodafone are fixed line telephone, broadband, internet television, mobile phone, digital television and so on. The aim of report is to discuss about external environment and their market conditions which is faced by it in current scenario with aid of PESTLE analysis. For knowing about inside aspects of business, internal analysis has done with help of SWOT. It has also covered strategies which can be followed by business. TASK 1 External environment and market conditions currently faced by the organisation and possible future scenario External environment is defined as set of all outside components or influence which impact on operation of business (Ansoff and et. al., 2018). These factors are uncontrollable by individualwhichdirectlyeffectonoperationandactivitiesofenterprise.Theexternal environment are measured through PESTLE analysis which is given below: PESTLE Analysis Itisdefinedasframeworkwhichhelpsinanalysingkeyfactorsthatinfluence organisation from outside environment. This include six factors which are explained below: PoliticalFactors-Itisdefinedaspoliticalconditionofmarketwhichincludes government rules and regulations, inflation and so on. Such factors are grown in twenty first century due to high pressure on international brands. These environment affect economic trade
Paraphrase This Document
Need a fresh take? Get an instant paraphrase of this document with our AI Paraphraser
and environment. The attitude of government towards tax and other affect business. Vodafone has market of Asia, Pacific, Europe, Middle East, Africa and so on. There is no political stability in such regions which affects profitability and sales. In context of telecommunication industry, it has faced high pressure because of increased in government policies, control. Economic Factors- This factors impact economic condition in terms of interest rate, inflation rate and so on. Such factors remain at core in global business. There is impact of performance of regional economies and global on international technology (PESTEL ANALYSIS OF VODAFONE GROUP, 2019). With rise in time, there is high demand for mobile and data services which assist telecommunication industry to rise high profit margin. Vodafone has market of Italy, India, UK and Spain. After Brexit, profitability of Vodafone has affected in UK. With decline in economic,purchasing power of consumer has affected sales as well as profitability of respective organisation. Social Factors- This factors includes age, income level of people and so on. The buying habits of consumers is change due to social trends and lifestyle. Each day, consumer has new preference and consumption pattern that leads to change in their buying behaviour. There is frequent rise in services of telecommunication sector which make user to switch from one to another. The enterprise as well as individual wants faster connection for work and entertainment purpose. Vodafone focus on providing high quality and fast services to their consumer in proper manner which assist in growth and develop at marketplace. Technological Factors- Vodafone is regarded as technology and brand to play central role in operation of business (Baumgartner and Rauter, 2017). It is growing their services from recent years which is based on growing of demand of enterprise and individuals. With growing role of user leads respective organisation to consider such aspect to provide better experience to consumers in proper manner. It is using digital technology in order to provide high convenience to consumers and growing user engagement. Users can use application of Vodafone for knowing about offers and services provided to people. It is using digital technology for doing promotions in an effective and efficient manner. Due to rise in technology, demand of consumers has increase that leads telecommunication industry to provide fast connectivity to users. Legal Factors- It include legal factors for operating business at marketplace. The law as well as legal factors are playing significant role in developing business. Vodafone has to be vigilant about legal issues such as pirated or copy. The respective organisation has faced issues
in terms of avoiding legal issues where it has faced penalty. It is also not paying more to employees as compared to rivals. In this context, individual leave Vodafone and join rivalry companies that maximise risks of leakage of innovative ideas. Therefore, it is very important for Vodafone to follow legal rules and regulations to create image at marketplace. Environment Factors- The business has to considered all environmental factors in order to run their activities and operations in an effective and efficient manner (Bettis and et. al., 2016). Nowadays, companies are investing more for reducing carbon footprints and making enterprise successful. The respective organisation also focus on managing carbon footprints and environmental impact to run activities and operations in effective and efficient manner. All environmental laws has to be followed to create good image and brand value at marketplace. It is very important for organisation to analyse market conditions and accordingly make decision to achieve goal and objectives in an effective and efficient manner. The market is analysed with help of Porter's model which is described here. Porter's Five Force Model Itisdefinedasframeworkwhichhelpsinanalysingcompetitiveenvironmentof company. This helps in knowing about issues faced by company within existing market domains. They are explained below: Bargaining Power of Buyer- The power of buyer is high in telecommunication industry because of cut throat competition and lack of same products (Vodafone Group Plc SWOT Analysis and Porters Five Forces, 2019). As buyer has high power which leads industry to reduce cost prices in order to beat competition at place. In context of Vodafone, it is making reasonable profits as comparing to competitors. Bargaining Power of Supplier- The suppliers of Vodafone has high bargaining power as it is operating their business with great margins comparing to competitors. It is leader in market due to which market share is large as it can absorb price increments through suppliers more than competitors. The respective organisation has capacity to maintain low prices from suppliers in order to make profits in proper manner. Threat of Substitutes- Vodafonefacemoderatethreatof substituteproductsand services. The CDMA and land-line services are declining whereas broadband services are fast growingandbecomingtoocommon.VOPIlikeGoogleTalk,Yahoomessenger,video conferencing,socialnetworking,emailhaveemergedandbecomesubstitutesformobile
services. Vodafone possess strong buyer power and economies of scale, due to which it does not have to cut down cost attribution to substitution for consumers. Threat of New Entrants- The threat of new entrants is low due to high barriers to entry (Certo and et. al., 2016). Companies which want to enter into telecommunication section has to payhugelicensingfeeswhichisnotpossibleforallbusinesstopay.Costofsetting infrastructure network is high and change in technology makes difficult for new business to enter into market. Vodafone faces low threat of entrants as it is very difficult to enter into marketplace. Competitive/ Industry Rivalry- Vodafone is facing extremely high rivalry due to their competitors as they are charging low call rate prices. There are many competitors who focus on providing innovative products and services to users which leads Vodafone to provide same to their users. Therefore, with help of PESTLE and Porter's five force model, environment as well as market condition, competitive advantage has analyse for achievement of goal and objectives in an effective and efficient manner. It is very important to analyse each and every factors, so that proper decision can be made in appropriate manner for maximum gains and profits. TASK 2 Use of relevant internal analysis tools to draw appropriate conclusions It is very important to analyse internal environment of business which is controllable in nature and better decisions are made. With analysis of internal surrounding, strength and weakness can be determined to know about opportunities and threats. It is explained below: SWOT Analysis It is defined as framework which helps in knowing about strong and weak point of business in an effective and efficient manner (David and David, 2019). This is technique which is used for assisting organisation or person for identifying strengths, weaknesses, opportunities and threats. SWOT analysis of Vodafone is described below: Strengths-Vodafone is a popular telecommunications brand with its presence across various geographical reasons. The brand comes up with various innovative ideas in order to constantly upgrade itself to get to level with its competitors. The brand has been able to establish a superior brand image with use of pug earlier and zoozoos afterwards which proved out to be
Secure Best Marks with AI Grader
Need help grading? Try our AI Grader for instant feedback on your assignments.
brilliant ideas. The company has a huge subscriber base all over world. By differentiating in services it offers, Vodafone has been able to penetrate into untapped market segments. Weaknesses-The brands' core values seem to be fading with a loss in subscriber base in last few years (Engert, Rauter and Baumgartner, 2016). Vodafone has not been able to perform well in European market, Brexit being one of the major reasons. It is majorly operating in Europe, it fails to leave a mark in the US. Vodafone has also very less presence in rural markets with Airtel, one of its major competitors having a huge presence in urban as well as rural markets. Opportunities-Being one of its weakness, the brand's presence in rural areas and other emerging markets is one of major opportunities (SWOT analysis of Vodafone – Vodafone SWOT analysis, 2019). With the number of people using smart phones is rising day by day, hence Vodafone can come up with new and exciting deals after carefully understanding the customers' needs and desires. There have been cases where at times the network coverage was poor. There fore, this arises the need for the brand to improve its network. The company can learn many things from “China Mobile” in terms of implementing innovative and new ideas. Sponsoring various events and being able to associate it with other brands can help in creating a new customer base as well as increasing number of already existing subscribers. Threats-With new brands entering into market, Vodafone faces serious competition from them as well as its already existing competitors. The brands should also work upon its pricing strategy in order to overcome low margins. Since Vodafone has been reported to have a low network coverage, there is a threat of people porting their networks to other networks. This can pose as a serious threat and also can result in a decrease in the company's customer base. With low presence, Vodafone still lags behind its competitors in the US. The competence and capabilities of company should be analysed in order to deliver, creates and captures value to their consumers. This can be explained with help of VRIO analysis which is described below: VRIO Analysis It is defined as analytical technique which aid in evaluating resources of company and competitive advantage (Ginter, Duncan and Swayne, 2018). This is important for Vodafone to analyse their resources and internal capabilities in an effective and efficient manner. There are four dimensions in this model which are explained in context of Vodafone such as:
Resources/CapabilitiesValuableRareImitableOrganisedImpact of Competitive Advantage ConnectivityYes---Competitive Disadvantage Infrastructureand Operations YesYes--Temporary competitive advantage Global PresenceYesYesYes-Unused competitive advantage Capable StaffYesYesNoYesLong term advantage Valuable- This is referred as capabilities which is creating high value for organisation in order to achieve goal and objective in appropriate manner (Hitt and Duane Ireland, 2017). Vodafone has some valuable resources such as connectivity, global presence, capable staff and infrastructure & operation. These resources are very important for respective business to attain high profit margin at marketplace. They are described below:Connectivity-TheconnectivityofVodafoneisverygoodascomparedtoother telecommunication industry. This assist business to increase their consumers for availing services in proper manner. It also assist in achievement of profits and gain by increasing number of users.Infrastructure and Operations- The infrastructure and operations is valuable resources of Vodafone which assist to carry out business operations and activities in effectual way. With such resources, users get proper services which is actually required to them. It is important to carry out each and every operations considering need and requirement of users.Global Presence- Vodafone is operating their business in global market which is valuable in nature for achievement of high profit margin in proper manner (Lasserre, 2017). This helps user to avail services and product at various places. Capable Staff- It is the significant valuable resources of Vodafone in order to attain set outcomes. The respective organisation has skilled, knowledgeable, experiences, capable and innovative staff to perform work for business.
Rare- It is referred as resources that are rare in nature for other business that leads to achieve competitive advantage at marketplace (Meyer, Neck and Meeks, 2017). The rare resources of Vodafone are infrastructure & operations, global presence and capable staff. They are described below:Infrastructure and Operations- Vodafone has innovative infrastructure and operation resources so that each and every employees can work in proper manner for desirable outcomes. With better operations, activities can be carried out in sequence without any obstacles.Global Presence- Vodafone is operating business in different parts of world for providing products and services to their consumers so that they can enjoy telecommunication facilities without any problems. It is rare resource which required huge brand value and goodwill to expand business at global market. Capable Staff- The staffs working in Vodafone are highly skilled, capable and innovative who focus on achieving main goal and objectives of business. With help of skills and capabilities of employees, they can come up with new ideas and innovative to survive in competitive marketplace. Imitable- It is referred as resources which are not copied by another enterprise (Michael, StoreyandThomas,2017).Theseresourcesassistingainingcompetitiveadvantageat marketplace. Vodafone has global presence and capable staff as imitable resources. They are mentioned below:Global Presence- The respective organisation has global presence which is imitable in nature. As it is not possible for other telecommunication to instantly globalised their business as it required long term sustainability, goodwill, profitability, brand value and goodwill. This is important resource of Vodafone to earn maximum profits and gains at marketplace. Capable Staff- In order to run business whether small or large, capable workforce is required. This resource is imitable in nature for other telecommunication industry. The respective organisation has highly skilled and educated employees to conduct business operation and activities at marketplace.
Paraphrase This Document
Need a fresh take? Get an instant paraphrase of this document with our AI Paraphraser
Organised- This is referred as those resources which should be organised by each and every organisation for positive results. Vodafone has to organised their components to attain set outcomes. The main resources which Vodafone organised is as follows: Capable Staff- This resources of Vodafone has to organised in proper manner. As they are the ultimate person who focus on achieving business goal and objectives. In context of telecommunication industry, it is very important to have skilled, qualified, educated staff for positive outcomes. They should be provided with proper facilities and salary so that they get attached to business and work for longer time period. Thus, it is very important for Vodafone to analyse internal environment, capabilities and resources for making positive decisions. With analysis of both model, it can be known about strong and weak point of organisation. The capabilities and resources are required in business to gain maximum results. TASK 3 Discuss the possible strategies that the company could follow to defend its core business In order to defend core business of firms, it is very essential for them to follow unique tools and strategies to achieve organisational goals and objectives in a proper way (Moutinho and Vargas-Sanchez, 2018). In this era of economy there huge competition between firms so that, each and every firm tried to have effective and attractive strategies by which they can influence large number of people and able make potential customers in a perfect way. There are different possible strategies which is followed by Vodafone, those are going to be discussed below: Ansoff Matrix This is very essential model in order to make strategic marketing planning in which it can be applied to look at numerous opportunities to grow effective revenue for a business through formulating new goods and services into the new markets (Rothaermel, 2017). Sometimes it is also known as product market matrix instead of Ansoff matrix. With the help of this model firms can easily focus on their entire growth of business and able to measure opportunities for firms to maximisationoftheirsalesbyhavingalternativecombinationsfornewmarkets,like geographical locations and customer segmentations. There are few stages which briefly explain about this model and helps Vodafone to understand marketing situation, those are discussed below:
Market penetration-Itis the type of successful selling of a goods and services within the specific market (Zhao and et. al., 2017). On the other side, it can be measured by entire amount of sales volume of an existing goods and services as per the comparison of total target market for those product and services. Apart from this it is the part of Ansoff's matrix which is generally utilised across the firm in order to determine next stages which will be taken by firm. In context with Vodafone, for successful growth they always choose this strategy by which they can implement on new things and able to sell its product in to the existing marketplace. By having this type of strategy they can obtain high market share value without facing any issue at marketplace. Market development-It is always considered as a growth strategy which is used to identifiesandformulatesnewsegmentationofmarketsforpresentgoodsandservices (Flotemersch and et. al., 2016). Along with this, it also target new customers at new segments. Therefore, marketing development strategy entails potential and expanding market by new users. As per this new users can be defined as the geographic segments and demographic segments. On the basis of this they can choose services or goods accordingly. In relation with Vodafone,this is very useful strategy in order to develop new product into the marketplace by focusing on segmentation geographically and demographically. Product and development-According to this strategy of Ansoff's model, it develops and create so many goods with different or new characteristics that generally offers huge and additional benefits to the customers at marketplace. In context with Vodafone they use this strategy as it involves changing or modification process of existing products as well as its presentation, along with formulation of new goods that satisfy newly defined customers. Therefore, this is the best way to evaluate marketing niche and current situation of market appropriately. Diversification-It is one of the best strategy and alternative growth within the Ansoff Matrix (Fynn and et. al., 2016). As it is the diversification strategy, with the help of this firms can achieve their goals and objectives properly. Along with firms able to develop new products for completely new market era. In context with Vodafone, in order to achieve business growth they are applying unique things in their product by which they can differentiate its product from the other firm at marketplace.
According to the above specified Ansoff's matrix model this can be said that, strategy which is used by Vodafone is Product diversification with the help of this respective firm is able to expand its business growth at marketplace. Along with they can bring so many unique things on their goods which directly influence people positively and defend its core business. Porter's Generic Strategies It is mainly based on firm's position within the business industry which identifies entire probability of firm is above or below the industry average (Koseoglu, 2016). So herein, the above average profitability is sustainable for firm to achieve competitive advantages in an effective way. Herein two types of competitive advantages usually combined with scope of activities which is overseeing by a firm to achieve organisational goals. Therefore, it includes few types of strategies which is going to be explained below in relation with Vodafone: Cost leadership-According to this, a firm fix the rate to become low cost producer within its industry. In context with Vodafone there are several sources of cost advantages which can be varied from the entire structure of an organisation. Along with it includes raw material, economies of scale, proprietary technology and so on. With the help of this firm can become low cost producer and able to gain profits in a perfect manner. Differentiation-In this firm seeks to be unique. According to the Vodafone, they widely used those elements which is liked by buyers the most (Morden, 2017). By having different types of attributes they can make its functions and operations attractive and able to give better rewards to its customers positively with premium price. Focus-This strategy focus on the cost which is overlooked by firm to gain cost advantages for targeting segments (Percy, 2016). On the other side, firm focus on differentiation strategies. In the case of Vodafone, they use this strategy in order to target customers and differentiate its goods within the marketplace. So that they can fulfil buyer's needs and demand within certain segment. From the above mentioned Porter's generic strategy model it has been concluded that, Vodafone used cost leadership strategies by which they can make effective price on their product and able to gain competitive advantages effectively. Along with this, if they put lower cost on its goods then they can make different types of potential customers so that they can fulfil their needs accordingly. Therefore, this model is very useful for this firm to achieve its targeted goals and increase entire business value in a successful manner.
Secure Best Marks with AI Grader
Need help grading? Try our AI Grader for instant feedback on your assignments.
CONCLUSION From the above report, it has summarised that strategic management is important for implementing proper plans and strategies in an organisation to achieve goal and objectives. It is required in each and every field to gain positive outcomes. In order to conduct business activities and operation, it is essential to analyse internal as well as external environment so that decisions can be made. The internal environment is known through SWOT analyse which present strong andweakpointofbusinessandexternalsurroundingpresentsthosefactorswhichare uncontrollable such as political, economic, technological, social, legal and environment. Before expanding business in any place, it is essential to analyse market condition of that place which is possible through Porter's five force model. Resource and capabilities are to be determined for maximum profits and gains, which is possible through use of VRIO analysis to get competitive advantage at marketplace. The organisation has to analyse various types of strategies and chose best one which provide them positive and maximum gain. It is very crucial to produce differentiated products and services at low cost so that large number of people buy and avail service.
REFERENCES Books and Journals Aguinis,H.,Edwards,J.R.andBradley,K.J.,2017.Improvingourunderstandingof moderation and mediation in strategic management research.Organizational Research Methods.20(4). pp.665-685. Ansoff, H. I. And et. al., 2018.Implanting strategic management. Springer. Baumgartner, R. J. and Rauter, R., 2017. Strategic perspectives of corporate sustainability management to develop a sustainable organization.Journal of Cleaner Production.140. pp.81-92. Bettis,R.A.andet.al.,2016.Creatingrepeatablecumulativeknowledgeinstrategic management: A call for a broad and deep conversation among authors, referees, and editors.Strategic Management Journal.37(2). pp.257-261. Certo,S. T.andet.al.,2016. SampleselectionbiasandHeckmanmodelsin strategic management research.Strategic Management Journal.37(13). pp.2639-2657. David, F. R. and David, F. R., 2019.Strategic management: A competitive advantage approach, concepts and cases. Pearson. Engert, S., Rauter, R. and Baumgartner, R. J., 2016. Exploring the integration of corporate sustainabilityintostrategicmanagement:aliteraturereview.Journalofcleaner production.112.pp.2833-2850. Flotemersch, J. E. and et. al., 2016. A watershed integrity definition and assessment approach to support strategic management of watersheds.River Research and Applications.32(7). pp.1654-1671. Fynn, R. W. And et. al., 2016. Strategic management of livestock to improve biodiversity conservationinAfricansavannahs:aconceptualbasisforwildlife–livestock coexistence.Journal of Applied Ecology.53(2). pp.388-397. Ginter, P. M., Duncan, W. J. and Swayne, L. E., 2018.The strategic management of health care organizations. John Wiley & Sons. Hitt, M. and Duane Ireland, R., 2017. The intersection of entrepreneurship and strategic management research.The Blackwell handbook of entrepreneurship, pp.45-63. Koseoglu, M. A., 2016. Mapping the institutional collaboration network of strategic management research: 1980–2014.Scientometrics.109(1). pp.203-226. Lasserre, P., 2017.Global strategic management. Macmillan International Higher Education. Meyer, G. D., Neck, H. M. and Meeks, M. D., 2017. The entrepreneurship‐strategic management interface.Strategic entrepreneurship: Creating a new mindset, pp.17-44. Michael,S.,Storey,D.andThomas,H.,2017.Discoveryandcoordinationinstrategic management and entrepreneurship.Strategic entrepreneurship: Creating a new mindset, pp.45-65. Morden, T., 2017.Principles of management. Routledge. Moutinho, L. and Vargas-Sanchez, A. eds., 2018.Strategic Management in Tourism, CABI Tourism Texts. Cabi. Percy, L., 2016.Strategic advertising management. Oxford University Press. Rothaermel, F. T., 2017.Strategic management. New York, NY: McGraw-Hill Education. Zhao, E. Y. and et. al., 2017. Optimal distinctiveness: Broadening the interface between institutional theory and strategic management.Strategic Management Journal.38(1). pp.93-113.
Online PESTELANALYSISOFVODAFONEGROUP.2019.[Online].Availablethrough: <https://notesmatic.com/2019/05/pestel-analysis-of-vodafone-group/>. Vodafone Group Plc SWOT Analysis and Porters Five Forces. 2019. [Online]. Available through:<https://writepass.com/journal/2012/09/vodafone-group-plc-swot-analysis- and-porters-five-forces/>. SWOT analysis of Vodafone – Vodafone SWOT analysis. 2019. [Online]. Available through: <https://www.marketing91.com/swot-analysis-vodafone/>.
Paraphrase This Document
Need a fresh take? Get an instant paraphrase of this document with our AI Paraphraser